PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr020288.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 371aa    MW: 41533.1 Da    PI: 7.1777
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr020288.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.57.4e-5551311129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeel+++yL++kv++ +++  +++++vd++k+ePwdLp k++ +ekewyfF  rd+ky+tg r+nrat++gyWk+tgkdke+++ +g 
  Pbr020288.1   5 LPPGFRFHPTDEELITHYLCPKVSDVSFTS-KAVADVDLNKCEPWDLPGKASMGEKEWYFFNLRDRKYPTGLRTNRATEAGYWKTTGKDKEIHR-TGV 100
                  79*************************999.88***************988999***************************************9.99* PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                  lvg+kktLvfykgrap+gek++Wvmheyrle
  Pbr020288.1 101 LVGMKKTLVFYKGRAPRGEKSNWVMHEYRLE 131
                  *****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.71E-643151IPR003441NAC domain
PROSITE profilePS5100559.9815151IPR003441NAC domain
PfamPF023651.5E-286130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MQESLPPGFR FHPTDEELIT HYLCPKVSDV SFTSKAVADV DLNKCEPWDL PGKASMGEKE  60
WYFFNLRDRK YPTGLRTNRA TEAGYWKTTG KDKEIHRTGV LVGMKKTLVF YKGRAPRGEK  120
SNWVMHEYRL ENKHPFNSSK EEWVVCRVFQ KSISALKKPQ QATTSSHQQP STESPCDDTN  180
SIVNEFGDIE LPNLNSNINA NSSSGFSNNI SSPPSYYSNI IDHSKNNIND VTNMSLNMNW  240
AATAAREAAT NAVSWPSSLL SPSNLSVNSL LLRALHLRSS TNNNCSNYQP RDTNHGQATA  300
GTSTLDYSSY NNMQQQGMMP SMSHHIGSST TMDHINSNFQ ASSSSIKDQM MESMPPQQHS  360
EQPFNLDSIW *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B9e-60215714171NAC domain-containing protein 19
4dul_A9e-60215714171NAC domain-containing protein 19
1ut7_B9e-60215714171NO APICAL MERISTEM PROTEIN
1ut7_A9e-60215714171NO APICAL MERISTEM PROTEIN
1ut4_B9e-60215714171NO APICAL MERISTEM PROTEIN
1ut4_A9e-60215714171NO APICAL MERISTEM PROTEIN
3swp_D9e-60215717174NAC domain-containing protein 19
3swp_C9e-60215717174NAC domain-containing protein 19
3swp_B9e-60215717174NAC domain-containing protein 19
3swp_A9e-60215717174NAC domain-containing protein 19
3swm_D9e-60215717174NAC domain-containing protein 19
3swm_C9e-60215717174NAC domain-containing protein 19
3swm_B9e-60215717174NAC domain-containing protein 19
3swm_A9e-60215717174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009347167.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1
TrEMBLM5WUQ11e-161M5WUQ1_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s03700.11e-149(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49463356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-107NAC domain containing protein 58